| FazBrowse GitHub Viewer | Trending | | Home |
| Tools: [Download Repo ZIP] [Original HTTPS Page] |
1 parent 2e3e051 commit d2b7cea
2 files changed
| Original file line number | Diff line number | Diff line change | |
|---|---|---|---|
@@ -3,9 +3,9 @@ BioJava 3 tutorial | |||
| 3 | 3 | ||
| 4 | 4 | A brief introduction into [BioJava 3](https://github.com/biojava/biojava). | |
| 5 | 5 | ||
| 6 | - == | ||
| 6 | + == | ||
| 7 | 7 | ||
| 8 | - The goal of this tutorial is to provide an educational introduction into some of the features that are provided by BioJava. | ||
| 8 | + The goal of this tutorial is to provide an educational introduction into some of the features that are provided by BioJava. | ||
| 9 | 9 | ||
| 10 | 10 | At the moment this tutorial is still under development. Please check the [BioJava Cookbook](http://biojava.org/wiki/BioJava:CookBook3.0) for a more comprehensive collection of many examples of what is possible with BioJava and how to do things. | |
| 11 | 11 | ||
@@ -21,6 +21,8 @@ Book 3: [The Protein Structure modules](structure/README.md), everything related | |||
| 21 | 21 | ||
| 22 | 22 | Book 4: [The Genomics Module](genomics/README.md), working with genomic data | |
| 23 | 23 | ||
| 24 | + Book 5: [The Protein-Disorder Module](protein-disorder/README.md), predicting protein-disorder. | ||
| 25 | + | ||
| 24 | 26 | ||
| 25 | 27 | ## License | |
| 26 | 28 | ||
| Original file line number | Diff line number | Diff line change | |
|---|---|---|---|
@@ -0,0 +1,122 @@ | |||
| 1 | + The Protein-Disorder Module of BioJava | ||
| 2 | + ===================================================== | ||
| 3 | + | ||
| 4 | + A tutorial for the protein-disorder module of [BioJava](http://www.biojava.org) | ||
| 5 | + | ||
| 6 | + ## About | ||
| 7 | + <table> | ||
| 8 | + <tr> | ||
| 9 | + <td> | ||
| 10 | + | ||
| 11 | + </td> | ||
| 12 | + <td> | ||
| 13 | + The <i>protein-disorder module</i> of BioJava provide an API that allows to | ||
| 14 | + <ul> | ||
| 15 | + <li>predict protein-disorder using the JRONN algorithm</li> | ||
| 16 | + </ul> | ||
| 17 | + | ||
| 18 | + | ||
| 19 | + </td> | ||
| 20 | + </tr> | ||
| 21 | + </table> | ||
| 22 | + | ||
| 23 | + ## How can I predict disordered regions on a protein sequence? | ||
| 24 | + ----------------------------------------------------------- | ||
| 25 | + | ||
| 26 | + BioJava provide a module *biojava-protein-disorder* for prediction | ||
| 27 | + disordered regions from a protein sequence. Biojava-protein-disorder | ||
| 28 | + module for now contains one method for the prediction of disordered | ||
| 29 | + regions. This method is based on the Java implementation of | ||
| 30 | + [RONN](http://www.strubi.ox.ac.uk/RONN) predictor. | ||
| 31 | + | ||
| 32 | + This code has been originally developed for use with | ||
| 33 | + [JABAWS](http://www.compbio.dundee.ac.uk/jabaws). We call this code | ||
| 34 | + *JRONN*. *JRONN* is based on the C implementation of RONN algorithm and | ||
| 35 | + uses the same model data, therefore gives the same predictions. JRONN | ||
| 36 | + based on RONN version 3.1 which is still current in time of writing | ||
| 37 | + (August 2011). Main motivation behind JRONN development was providing an | ||
| 38 | + implementation of RONN more suitable to use by the automated analysis | ||
| 39 | + pipelines and web services. Robert Esnouf has kindly allowed us to | ||
| 40 | + explore the RONN code and share the results with the community. | ||
| 41 | + | ||
| 42 | + Original version of RONN is described in [Yang,Z.R., Thomson,R., | ||
| 43 | + McMeil,P. and Esnouf,R.M. (2005) RONN: the bio-basis function neural | ||
| 44 | + network technique applied to the detection of natively disordered | ||
| 45 | + regions in proteins. Bioinformatics 21: | ||
| 46 | + 3369-3376](http://bioinformatics.oxfordjournals.org/content/21/16/3369.full) | ||
| 47 | + | ||
| 48 | + Examples of use are provided below. For more information please refer to | ||
| 49 | + JronnExample testcases. | ||
| 50 | + | ||
| 51 | + Finally instead of an API calls you can use a [ command line | ||
| 52 | + utility](/wikis/BioJava:CookBook3:ProteinDisorderCLI "wikilink"), which is | ||
| 53 | + likely to give you a better performance as it uses multiple threads to | ||
| 54 | + perform calculations. | ||
| 55 | + | ||
| 56 | + Example 1: Calculate the probability of disorder for every residue in the sequence | ||
| 57 | + ---------------------------------------------------------------------------------- | ||
| 58 | + | ||
| 59 | + ```java | ||
| 60 | + FastaSequence fsequence = new FastaSequence("name", | ||
| 61 | + "LLRGRHLMNGTMIMRPWNFLNDHHFPKFFPHLIEQQAIWLADWWRKKHC" + | ||
| 62 | + "RPLPTRAPTMDQWDHFALIQKHWTANLWFLTFPFNDKWGWIWFLKDWTPGSADQAQRACTWFFCHGHDTN"); | ||
| 63 | + | ||
| 64 | + float[] rawProbabilityScores = Jronn.getDisorderScores(fsequence); | ||
| 65 | + ``` | ||
| 66 | + | ||
| 67 | + Example 2: Calculate the probability of disorder for every residue in the sequence for all proteins from the FASTA input file | ||
| 68 | + ----------------------------------------------------------------------------------------------------------------------------- | ||
| 69 | + | ||
| 70 | + ```java | ||
| 71 | + final List<FastaSequence> sequences = SequenceUtil.readFasta(new FileInputStream("src/test/resources/fasta.in")); | ||
| 72 | + Map<FastaSequence, float[]> rawProbabilityScores = Jronn.getDisorderScores(sequences); ``` | ||
| 73 | + | ||
| 74 | + Example 3: Get the disordered regions of the protein for a single protein sequence | ||
| 75 | + ---------------------------------------------------------------------------------- | ||
| 76 | + | ||
| 77 | + ```java | ||
| 78 | + FastaSequence fsequence = new FastaSequence("Prot1", "LLRGRHLMNGTMIMRPWNFLNDHHFPKFFPHLIEQQAIWLADWWRKKHC" + | ||
| 79 | + "RPLPTRAPTMDQWDHFALIQKHWTANLWFLTFPFNDKWGWIWFLKDWTPGSADQAQRACTWFFCHGHDTN" + | ||
| 80 | + "CQIIFEGRNAPERADPMWTGGLNKHIIARGHFFQSNKFHFLERKFCEMAEIERPNFTCRTLDCQKFPWDDP"); | ||
| 81 | + | ||
| 82 | + Range[] ranges = Jronn.getDisorder(fsequence); | ||
| 83 | + ``` | ||
| 84 | + | ||
| 85 | + Example 4: Calculate the disordered regions for the proteins from FASTA file | ||
| 86 | + ---------------------------------------------------------------------------- | ||
| 87 | + | ||
| 88 | + ```java | ||
| 89 | + final List<FastaSequence> sequences = SequenceUtil.readFasta(new FileInputStream("src/test/resources/fasta.in")); | ||
| 90 | + Map<FastaSequence, Range[]> ranges = Jronn.getDisorder(sequences); | ||
| 91 | + | ||
| 92 | + ``` | ||
| 93 | + | ||
| 94 | + | ||
| 95 | + ### Author: | ||
| 96 | + | ||
| 97 | + [Andreas Prlić](https://github.com/andreasprlic) | ||
| 98 | + | ||
| 99 | + ## Please cite | ||
| 100 | + | ||
| 101 | + **BioJava: an open-source framework for bioinformatics in 2012**<br/> | ||
| 102 | + *Andreas Prlic; Andrew Yates; Spencer E. Bliven; Peter W. Rose; Julius Jacobsen; Peter V. Troshin; Mark Chapman; Jianjiong Gao; Chuan Hock Koh; Sylvain Foisy; Richard Holland; Gediminas Rimsa; Michael L. Heuer; H. Brandstatter-Muller; Philip E. Bourne; Scooter Willis* <br/> | ||
| 103 | + [Bioinformatics (2012) 28 (20): 2693-2695.](http://bioinformatics.oxfordjournals.org/content/28/20/2693.abstract) <br/> | ||
| 104 | + [](http://bioinformatics.oxfordjournals.org/content/28/20/2693.abstract) [](http://www.ncbi.nlm.nih.gov/pubmed/22877863) | ||
| 105 | + | ||
| 106 | + ## License | ||
| 107 | + | ||
| 108 | + The content of this tutorial is available under the [CC-BY](http://creativecommons.org/licenses/by/3.0/) license. | ||
| 109 | + | ||
| 110 | + [view license](../license.md) | ||
| 111 | + | ||
| 112 | + | ||
| 113 | + | ||
| 114 | + <!--automatically generated footer--> | ||
| 115 | + | ||
| 116 | + --- | ||
| 117 | + | ||
| 118 | + Navigation: | ||
| 119 | + [Home](../README.md) | ||
| 120 | + | Book 3: The Protein Structure modules | ||
| 121 | + | ||
| 122 | + Prev: [Book 4: The Genomics Module](../genomics/README.md) | ||
| Back | FazBrowse Home | New Git URL |
0 commit comments